PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_24092
Common NameKK1_025456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 322aa    MW: 36102.7 Da    PI: 6.7133
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_24092genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l d ++++G g+W++ ++  g++R++k+c++rw +yl
    C.cajan_24092 14 KGPWSPEEDKILMDFIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.28e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++l++++++ lG++ W++Ia++++ gRt++++k++w+++l
    C.cajan_24092  67 RGKFSDEEEKLIINLHAVLGNK-WAAIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.15961IPR017930Myb domain
SuperFamilySSF466892.2E-3111108IPR009057Homeodomain-like
SMARTSM007172.4E-141363IPR001005SANT/Myb domain
PfamPF002496.6E-171461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-241568IPR009057Homeodomain-like
CDDcd001673.59E-111661No hitNo description
PROSITE profilePS5129426.81262116IPR017930Myb domain
SMARTSM007171.9E-1766114IPR001005SANT/Myb domain
PfamPF002498.9E-1767112IPR001005SANT/Myb domain
CDDcd001676.94E-1369112No hitNo description
Gene3DG3DSA:1.10.10.602.0E-2769116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MMRTPSNDES GLKKGPWSPE EDKILMDFIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SDEEEKLIIN LHAVLGNKWA AIASHLPGRT DNEIKNFWNT HLKKKLLQMG  120
LDPMTHRPRT DHLSLLSNLQ QILAAAKIVS SFTNPCDINN ALRLQSDATQ LAKLQLLQNM  180
FQVSNSDPLN PFGSLNSLPD ALVNDVLGLN NLSNLQNLYD GTSLGFSSQI QANNFQNFEA  240
PQEPTQHMNG GRNSGCKESE KLDEQFGSTT SNSSLPNLVC ASPERSAEKM VNSKECSTSF  300
ELTWGDLMDE EPTETYWKGF IE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006573852.11e-173PREDICTED: transcription factor MYB39-like
TrEMBLA0A151SD710.0A0A151SD71_CAJCA; Transcription factor MYB39
STRINGGLYMA01G44370.21e-173(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-94myb domain protein 9